PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00018.1.g06640.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 481aa    MW: 49786.8 Da    PI: 9.7875
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00018.1.g06640.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.71.3e-28249298251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zjn_sc00018.1.g06640.1.sm.mk 249 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 298
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-13246299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-25247298IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-21249299IPR006447Myb domain, plants
PfamPF002492.1E-5250298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPNS SAPGSGPAGG RAAAGGAGGG GVGGDPWRRL NWSTELSLSP  60
PAEPDADALP LRHRPSAAAS SSAATTSSVR MMPMPTLQPL DAGGGGGGGG ASAAPPIRGI  120
PIYNGPGGFP FLPPAAGGDQ QKVGFYGSYH HPATWPSSLG STSLSPLAPG ASPLDPASAF  180
LSPAAHHHHR MLSASGRLNG MLTDTLRGYG SAGGLGGIGG HHHLHGAQLF GLGSRFMPKL  240
PAKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQVR  300
GCRPPLPLNS PKTRAFCFVY LLPFLLLFGS DKNTNAVTPE LVNDGETDDG WRLAAKKLPF  360
LGGRERGERK MYRTVKSTDK PAASSGPADG GSGDDEFSGA GQTASGGDNN MCARLFGEHR  420
STSEGAASSL GRGGDMDQST ARNTSTRWSN SSREGWKQGP LDVVELMQHG CSSLGRFVVS  480
D
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253981e-104EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546671e-104EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147322.11e-116milkweed pod1
SwissprotQ0J2352e-77ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLB5LZ601e-115B5LZ60_MAIZE; Milkweed pod1
STRINGGRMZM2G082264_P011e-115(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-35G2-like family protein